PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 472297
Common NameARALYDRAFT_472297
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 843aa    MW: 94059.7 Da    PI: 5.1978
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
472297genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29555605252
  RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
              k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  472297 555 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 605
             689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154539625IPR003035RWP-RK domain
PfamPF020423.3E-25557605IPR003035RWP-RK domain
SuperFamilySSF542771.1E-22733830No hitNo description
SMARTSM006664.9E-26742825IPR000270PB1 domain
PROSITE profilePS5174529.403742825IPR000270PB1 domain
CDDcd064078.90E-43743823No hitNo description
Gene3DG3DSA:3.10.20.2407.1E-21743822No hitNo description
PfamPF005648.1E-20743824IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MEDSFLQSEN AVMDADFMDG LLLDGCWLET TDGSEFLNIA PSTSSVSPFD PSSFMWSPTQ  60
DTSALCTSGV VSQMYGQDCV ERSSLDEFQW NKRWWIGPGG GGSSVTERLV QAVEYIKDYT  120
TERGSLIQLW VPVNRGGKRV LTTKEQPFSH DPLCQRLANY REISVKYQFS AEQDDSKALT  180
GLPGRVFLGK LPEWTPDVRF FKSEEYPRVH HAQDCGVRGT LAIPVFEQGS KICLGVIEVV  240
MTTEMVKLRP ELESICRALQ AVDLRSTELP IPPTLKGCDL SYQAALPEIR NLLRCACETH  300
KLPLAQTWVS CQQQNKSGCR HNDENYIHCV STIDDACYVG DPTVREFHEA CSEHHLLKGQ  360
GVAGQAFLTN GPCFSSDVSN YKKSEYPLSH HANMYGLHGA VAIRLRCIHT GPADFVLEFF  420
LPKECDDLEE QRTMLNALST IMAHVPRSLR TVTDKELEEE SEVIEREEIV TPKIENASEL  480
HGNSPWNASL EEIQRSNNTS NPQNLGLVFD GGEPHDGFGL KRGFDYTMDS NVNESSTFSS  540
GGFSMMAEKK RTKADKTITL DVLRQYFAGS LKDAAKNIGV CPTTLKRICR QHGIQRWPSR  600
KIKKVGHSLQ KIQRVIDSVQ GVSGPLPIGS FYANFPNLVS QSQEPSQAKT SPPPPPPVQL  660
AKSPVSSYSH SSNSSQCCSS ETQLNSGATT DPPSTDVVGS LKKTSSEIEL QSSSLDETIL  720
TLSSLENIPQ GTNLLSSQDD DFLRIKVSYG EEKIRLRMRN SRRLTDLLWE IGKRFSIEDM  780
SRYDLKYLDE DNEWVLLTCD EDVEECVDVC RTTPSHTIKL LLQVSSHHFP ERSSATEYSL  840
WH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890396.10.0RWP-RK domain-containing protein
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLD7KJ390.0D7KJ39_ARALL; RWP-RK domain-containing protein
STRINGfgenesh2_kg.1__2251__AT1G20640.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein